Recombinant Human PABPC1, His-tagged
Cat.No. : | PABPC1-30620TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 96-636 of Human PABP with N terminal His tag; Predicted MWt 61 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 96-636 a.a. |
Description : | This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3 poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitment and translation initiation; it is also required for poly(A) shortening which is the first step in mRNA decay. The gene is part of a small gene family including three protein-coding genes and several pseudogenes. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 149 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN GSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRF KSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLF GKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVD EMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRIT RYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYV ALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPA PPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGAR PHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQR VANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRN PQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQE QKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPT V |
Gene Name | PABPC1 poly(A) binding protein, cytoplasmic 1 [ Homo sapiens ] |
Official Symbol | PABPC1 |
Synonyms | PABPC1; poly(A) binding protein, cytoplasmic 1; PAB1, PABPC2, poly(A) binding protein, cytoplasmic 2; polyadenylate-binding protein 1; PABP1; PABPL1; |
Gene ID | 26986 |
mRNA Refseq | NM_002568 |
Protein Refseq | NP_002559 |
MIM | 604679 |
Uniprot ID | P11940 |
Chromosome Location | 8q22.2-q23 |
Pathway | Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Destabilization of mRNA by AUF1 (hnRNP D0), organism-specific biosystem; |
Function | RNA binding; nucleotide binding; poly(A) RNA binding; poly(A) RNA binding; protein C-terminus binding; |
◆ Recombinant Proteins | ||
GSTM6-7335M | Recombinant Mouse GSTM6 Protein | +Inquiry |
EGFR-102MA | Recombinant Mouse EGFR protein, Fc-tagged, APC labeled | +Inquiry |
RFL33688RF | Recombinant Full Length Rickettsia Africae Probable Intracellular Septation Protein A (Raf_Orf0501) Protein, His-Tagged | +Inquiry |
STRA6-5803R | Recombinant Rat STRA6 Protein | +Inquiry |
CSDE1-3642H | Recombinant Human VAMP8, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C1q-07R | Native Rat C1q Protein | +Inquiry |
eCG-01E | Active Native Equine Gonadotropin protein | +Inquiry |
C6-101H | Native Human C6 Protein | +Inquiry |
Trypsin-251H | Active Native Human Trypsin | +Inquiry |
CSK-27872TH | Native Human CSK | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPP2-4232HCL | Recombinant Human MPP2 293 Cell Lysate | +Inquiry |
GSKIP-8288HCL | Recombinant Human C14orf129 293 Cell Lysate | +Inquiry |
KDR-417HCL | Recombinant Human KDR cell lysate | +Inquiry |
SEMA3C-1980HCL | Recombinant Human SEMA3C 293 Cell Lysate | +Inquiry |
FAM54B-6367HCL | Recombinant Human FAM54B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PABPC1 Products
Required fields are marked with *
My Review for All PABPC1 Products
Required fields are marked with *
0
Inquiry Basket