Recombinant Human P2RY1 protein, His-tagged

• Cat.No.: P2RY1-5645H
• Product Overview: Recombinant Human P2RY1 protein(P47900)(326-373aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 326-373aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 12.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL

Gene Information

• Gene Name: P2RY1 purinergic receptor P2Y, G-protein coupled, 1 [ Homo sapiens ]
• Official Symbol: P2RY1
• Synonyms: P2RY1; purinergic receptor P2Y, G-protein coupled, 1; P2Y purinoceptor 1; P2Y1; ATP receptor; platelet ADP receptor; P2 purinoceptor subtype Y1
• Gene ID: 5028
• mRNA Refseq: NM_002563
• Protein Refseq: NP_002554
• MIM: 601167
• UniProt ID: P47900