Recombinant Full Length Bovine P2Y Purinoceptor 1(P2Ry1) Protein, His-Tagged
Cat.No. : | RFL11785BF |
Product Overview : | Recombinant Full Length Bovine P2Y purinoceptor 1(P2RY1) Protein (P48042) (1-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-373) |
Form : | Lyophilized powder |
AA Sequence : | MTEVLWPAVPNGTDTAFLADPGSPWGNSTVTSTAAVASPFKCALTKTGFQFYYLPAVYIL VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAVYISVLVWLIVV VGISPILFYSGTGIRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCAFND RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN ILSEFKQNGDTSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | P2RY1 |
Synonyms | P2RY1; P2Y purinoceptor 1; P2Y1; ATP receptor; Purinergic receptor |
UniProt ID | P48042 |
◆ Recombinant Proteins | ||
P2RY1-12272M | Recombinant Mouse P2RY1 Protein | +Inquiry |
RFL16968HF | Recombinant Full Length Human P2Y Purinoceptor 1(P2Ry1) Protein, His-Tagged | +Inquiry |
P2ry1-0496M | Recombinant Mouse P2ry1 Full Length Transmembrane protein, His-tagged | +Inquiry |
P2RY1-6885C | Recombinant Chicken P2RY1 | +Inquiry |
RFL35980GF | Recombinant Full Length Chicken P2Y Purinoceptor 1(P2Ry1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RY1-1267HCL | Recombinant Human P2RY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All P2RY1 Products
Required fields are marked with *
My Review for All P2RY1 Products
Required fields are marked with *
0
Inquiry Basket