Recombinant Human OXT Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: OXT-5670H
• Product Overview: OXT MS Standard C13 and N15-labeled recombinant protein (NP_000906) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions.
• Molecular Mass: 12.72 kDa
• AA Sequence: MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: OXT oxytocin/neurophysin I prepropeptide [ Homo sapiens (human) ]
• Official Symbol: OXT
• Synonyms: OXT; oxytocin, prepropeptide; OT, oxytocin, prepro (neurophysin I); oxytocin-neurophysin 1; neurophysin I; oxytocin, prepro- (neurophysin I); oxytocin-neurophysin I, preproprotein; OT; OT-NPI; MGC126890; MGC126892
• Gene ID: 5020
• mRNA Refseq: NM_000915
• Protein Refseq: NP_000906
• MIM: 167050
• UniProt ID: P01178