Recombinant Human OTOS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | OTOS-5418H |
Product Overview : | OTOS MS Standard C13 and N15-labeled recombinant protein (NP_683764) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 9.9 kDa |
AA Sequence : | MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTFFAHFPLGSTLGFHVPYQEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | OTOS otospiralin [ Homo sapiens (human) ] |
Official Symbol | OTOS |
Synonyms | OTOS; otospiralin; OTOSP; otospiralin |
Gene ID | 150677 |
mRNA Refseq | NM_148961 |
Protein Refseq | NP_683764 |
MIM | 607877 |
UniProt ID | Q8NHW6 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OTOS Products
Required fields are marked with *
My Review for All OTOS Products
Required fields are marked with *
0
Inquiry Basket