Recombinant Human OTOR

• Cat.No.: OTOR-28850TH
• Product Overview: Recombinant full length Human Otoraplin ; 111 amino acids, predicted MWt 12.7 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• ProteinLength: 111 amino acids
• Description: The protein encoded by this gene is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness. This gene is a member of the melanoma-inhibiting activity gene family. In addition, alternate polyA sites exist for this gene.
• Molecular Weight: 12.700kDa
• Tissue specificity: Highly expressed in cochlea.
• Form: Lyophilised:Reconstitute the lyophilized Otoraplin in 50ul sterile ultra pure.
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 7.40Constituents:0.19% PBS, 0.75% Sodium chloride
• Storage: Please see Notes section
• Sequences of amino acids: VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRF INVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVV GYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
• Sequence Similarities: Belongs to the MIA/OTOR family.Contains 1 SH3 domain.

Gene Information

• Gene Name: OTOR otoraplin [ Homo sapiens ]
• Official Symbol: OTOR
• Synonyms: OTOR; otoraplin; FDP; MIAL; MIAL1
• Gene ID: 56914
• mRNA Refseq: NM_020157
• Protein Refseq: NP_064542
• MIM: 606067
• Uniprot ID: Q9NRC9
• Chromosome Location: 20p12.1-p11.23