Recombinant Human OSM Protein
Cat.No. : | OSM-522H |
Product Overview : | Recombinant human OSM protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 252 |
Description : | This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells. This gene and the related gene, leukemia inhibitory factor, also present on chromosome 22, may have resulted from the duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. |
Form : | Lyophilized |
AA Sequence : | MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | OSM oncostatin M [ Homo sapiens (human) ] |
Official Symbol | OSM |
Synonyms | OSM; oncostatin M; oncostatin-M; MGC20461; |
Gene ID | 5008 |
mRNA Refseq | NM_020530 |
Protein Refseq | NP_065391 |
MIM | 165095 |
UniProt ID | P13725 |
◆ Recombinant Proteins | ||
OSM-064O | Active Recombinant Human OSM Protein (209 aa) | +Inquiry |
OSM-321O | Active Recombinant Human OSM Protein (228 aa) | +Inquiry |
Osm-760M | Recombinant Mouse Osm protein, His-tagged | +Inquiry |
OSM-322O | Active Recombinant Human OSM Protein (210 aa) | +Inquiry |
Osm-4619M | Recombinant Mouse Osm Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *
0
Inquiry Basket