Recombinant Human ONECUT2 protein, His-tagged

Cat.No. : ONECUT2-3539H
Product Overview : Recombinant Human ONECUT2 protein(226-332 aa), fused to His tag, was expressed in E. coli.
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Protein length : 226-332 aa
AA Sequence : PLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEE
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ONECUT2 one cut homeobox 2 [ Homo sapiens ]
Official Symbol ONECUT2
Synonyms ONECUT2; one cut homeobox 2; one cut domain, family member 2; one cut domain family member 2; OC 2; onecut 2; HNF-6-beta; transcription factor ONECUT-2; hepatocyte nuclear factor 6-beta; ONECUT-2 homeodomain transcription factor; OC2; OC-2; MGC120377; MGC120378;
Gene ID 9480
mRNA Refseq NM_004852
Protein Refseq NP_004843
MIM 604894
UniProt ID O95948

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ONECUT2 Products

Required fields are marked with *

My Review for All ONECUT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon