Recombinant Human ONECUT2 protein, His-tagged

• Cat.No.: ONECUT2-3539H
• Product Overview: Recombinant Human ONECUT2 protein(226-332 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 226-332 aa
• AA Sequence: PLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEE
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ONECUT2 one cut homeobox 2 [ Homo sapiens ]
• Official Symbol: ONECUT2
• Synonyms: ONECUT2; one cut homeobox 2; one cut domain, family member 2; one cut domain family member 2; OC 2; onecut 2; HNF-6-beta; transcription factor ONECUT-2; hepatocyte nuclear factor 6-beta; ONECUT-2 homeodomain transcription factor; OC2; OC-2; MGC120377; MGC120378
• Gene ID: 9480
• mRNA Refseq: NM_004852
• Protein Refseq: NP_004843
• MIM: 604894
• UniProt ID: O95948