Recombinant Human OMP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: OMP-4462H
• Product Overview: OMP MS Standard C13 and N15-labeled recombinant protein (NP_006180) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse knockout studies show that OMP-null mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade.
• Molecular Mass: 18.8 kDa
• AA Sequence: MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQLSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: OMP olfactory marker protein [ Homo sapiens (human) ]
• Official Symbol: OMP
• Synonyms: OMP; olfactory marker protein; olfactory neuronal-specific protein
• Gene ID: 4975
• mRNA Refseq: NM_006189
• Protein Refseq: NP_006180
• MIM: 164340
• UniProt ID: P47874