Recombinant Human OMP

• Cat.No.: OMP-26853TH
• Product Overview: Recombinant fragment corresponding to amino acids 65-163 of Human Olfactory Marker Protein with N terminal proprietary tag; Predicted MWt 36.52.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man.The OMP gene structure and protein sequence are highly conserved between mouse, rat and human.Results of the mouse knockout studies show that OMP-null mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade.
• Molecular Weight: 36.520kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL

Gene Information

• Gene Name: OMP olfactory marker protein [ Homo sapiens ]
• Official Symbol: OMP
• Synonyms: OMP; olfactory marker protein
• Gene ID: 4975
• mRNA Refseq: NM_006189
• Protein Refseq: NP_006180
• MIM: 164340
• Uniprot ID: P47874
• Chromosome Location: 11q14-q21
• Function: signal transducer activity