Recombinant Human OCA2 protein, His-tagged

• Cat.No.: OCA2-2919H
• Product Overview: Recombinant Human OCA2 protein(1-174 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-174 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNSLQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPHIRLRLSKLRRC
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: OCA2 oculocutaneous albinism II [ Homo sapiens ]
• Official Symbol: OCA2
• Synonyms: OCA2; oculocutaneous albinism II; D15S12, EYCL2, EYCL3, eye color 2 (central brown) , eye color 3 (brown) , oculocutaneous albinism II (pink eye dilution (murine) homolog) , oculocutaneous albinism II (pink eye dilution homolog, mouse) , P; P protein; BEY; BEY1; BEY2; EYCL; melanocyte specific transporter protein; eye color 3 (brown); hair color 3 (brown); eye color 2 (central brown); total brown iris pigmentation; pink-eyed dilution protein homolog; melanocyte-specific transporter protein; oculocutaneous albinism II (pink-eye dilution homolog, mouse); P; PED; BOCA; HCL3; EYCL2; EYCL3; SHEP1; D15S12
• Gene ID: 4948
• mRNA Refseq: NM_000275
• Protein Refseq: NP_000266
• MIM: 611409
• UniProt ID: Q04671