Recombinant Human OCA2

Cat.No. : OCA2-30532TH
Product Overview : Recombinant fragment of Human P protein with a N terminal proprietary tag; Predicted MWt 36.63 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETV
Sequence Similarities : Belongs to the CitM (TC 2.A.11) transporter family.
Gene Name OCA2 oculocutaneous albinism II [ Homo sapiens ]
Official Symbol OCA2
Synonyms OCA2; oculocutaneous albinism II; D15S12, EYCL2, EYCL3, eye color 2 (central brown) , eye color 3 (brown) , oculocutaneous albinism II (pink eye dilution (murine) homolog) , oculocutaneous albinism II (pink eye dilution homolog, mouse) , P; P protein;
Gene ID 4948
mRNA Refseq NM_000275
Protein Refseq NP_000266
MIM 611409
Uniprot ID Q04671
Chromosome Location 15q11.2-q12
Function L-tyrosine transmembrane transporter activity; arsenite transmembrane transporter activity; citrate transmembrane transporter activity; protein binding; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All OCA2 Products

Required fields are marked with *

My Review for All OCA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon