Recombinant Human OAS1, His-tagged
Cat.No. : | OAS1-27767TH |
Product Overview : | Recombinant full length Human OAS1, isoform p41 with N terminal His tag; 384 amino acids with a predicted MWt 43.9kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 364 amino acids |
Description : | This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2-specific nucleotidyl transfer reactions to synthesize 2,5-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described. |
Conjugation : | HIS |
Molecular Weight : | 43.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMMDLRNTPAKSLDKFIEDYL LPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQ EIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQ LGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDL QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCK KKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLE LVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPV SSWILLVRPPASSLPFIPAPLHEA |
Sequence Similarities : | Belongs to the 2-5A synthase family. |
Gene Name | OAS1 2-5-oligoadenylate synthetase 1, 40/46kDa [ Homo sapiens ] |
Official Symbol | OAS1 |
Synonyms | OAS1; 2-5-oligoadenylate synthetase 1, 40/46kDa; 2,5 oligoadenylate synthetase 1 (40 46 kD) , OIAS; 2-5-oligoadenylate synthase 1; IFI 4; OIASI; |
Gene ID | 4938 |
mRNA Refseq | NM_001032409 |
Protein Refseq | NP_001027581 |
Uniprot ID | P00973 |
Chromosome Location | 12q24.2 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function | 2-5-oligoadenylate synthetase activity; ATP binding; double-stranded RNA binding; nucleotide binding; nucleotidyltransferase activity; |
◆ Recombinant Proteins | ||
Mtfr1-4208M | Recombinant Mouse Mtfr1 Protein, Myc/DDK-tagged | +Inquiry |
CLDN5-1436R | Recombinant Rat CLDN5 Protein | +Inquiry |
MAPT-173H | Recombinant Human Tau-441 (99-441) | +Inquiry |
TMPRSS15-1281P | Recombinant Porcine Transmembrane Protease, Serine 15 | +Inquiry |
RFL35339ZF | Recombinant Full Length Zea Mays Derlin-1.2(Der1.2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FN1-4399H | Native Human FN1 Protein | +Inquiry |
Ferritin-026H | Native Human Ferritin Protein, holo form | +Inquiry |
Collagen type I-01H | Native Human Collagen type I Protein | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
◆ Cell & Tissue Lysates | ||
KATNA1-888HCL | Recombinant Human KATNA1 cell lysate | +Inquiry |
SEPT7-1953HCL | Recombinant Human SEPT7 293 Cell Lysate | +Inquiry |
UCP3-524HCL | Recombinant Human UCP3 293 Cell Lysate | +Inquiry |
TMA7-7750HCL | Recombinant Human CCDC72 293 Cell Lysate | +Inquiry |
FAM104A-6461HCL | Recombinant Human FAM104A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OAS1 Products
Required fields are marked with *
My Review for All OAS1 Products
Required fields are marked with *
0
Inquiry Basket