Recombinant Human NUDT3 protein, His-tagged

• Cat.No.: NUDT3-376H
• Product Overview: Recombinant Human NUDT3 protein(NP_006694)(1-172 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-172 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: NUDT3 nudix (nucleoside diphosphate linked moiety X)-type motif 3 [ Homo sapiens ]
• Official Symbol: NUDT3
• Synonyms: NUDT3; nudix (nucleoside diphosphate linked moiety X)-type motif 3; diphosphoinositol polyphosphate phosphohydrolase 1; DIPP; nudix motif 3; nucleoside diphosphate-linked moiety X motif 3; diadenosine 5,5-P1,P6-hexaphosphate hydrolase 1; DIPP1; DIPP-1
• Gene ID: 11165
• mRNA Refseq: NM_006703
• Protein Refseq: NP_006694
• MIM: 609228
• UniProt ID: O95989