Recombinant Human NUDT10, His-tagged

• Cat.No.: NUDT10-28046TH
• Product Overview: Recombinant full length Human NUDT10 with a C terminal His tag; 172 amino acids with tag, Predicted MWt 19.5kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 164 amino acids
• Description: NUDT10 belongs to a subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (Hidaka et al.
• Conjugation: HIS
• Molecular Weight: 19.500kDa inclusive of tags
• Tissue specificity: Mainly expressed in testis and, at lower level in brain. According to PubMed:12121577, it is widely expressed.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDPLEHHHHHH
• Sequence Similarities: Belongs to the Nudix hydrolase family. DIPP subfamily.Contains 1 nudix hydrolase domain.

Gene Information

• Gene Name: NUDT10 nudix (nucleoside diphosphate linked moiety X)-type motif 10 [ Homo sapiens ]
• Official Symbol: NUDT10
• Synonyms: NUDT10; nudix (nucleoside diphosphate linked moiety X)-type motif 10; diphosphoinositol polyphosphate phosphohydrolase 3-alpha; DIPP3a; hDIPP3alpha
• Gene ID: 170685
• mRNA Refseq: NM_153183
• Protein Refseq: NP_694853
• MIM: 300527
• Uniprot ID: Q8NFP7
• Chromosome Location: Xp11.22-p11.1
• Function: diphosphoinositol-polyphosphate diphosphatase activity; hydrolase activity; metal ion binding