Recombinant Human NUDT10, His-tagged
Cat.No. : | NUDT10-28046TH |
Product Overview : | Recombinant full length Human NUDT10 with a C terminal His tag; 172 amino acids with tag, Predicted MWt 19.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 164 amino acids |
Description : | NUDT10 belongs to a subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (Hidaka et al. |
Conjugation : | HIS |
Molecular Weight : | 19.500kDa inclusive of tags |
Tissue specificity : | Mainly expressed in testis and, at lower level in brain. According to PubMed:12121577, it is widely expressed. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDPLEHHHHHH |
Sequence Similarities : | Belongs to the Nudix hydrolase family. DIPP subfamily.Contains 1 nudix hydrolase domain. |
Gene Name | NUDT10 nudix (nucleoside diphosphate linked moiety X)-type motif 10 [ Homo sapiens ] |
Official Symbol | NUDT10 |
Synonyms | NUDT10; nudix (nucleoside diphosphate linked moiety X)-type motif 10; diphosphoinositol polyphosphate phosphohydrolase 3-alpha; DIPP3a; hDIPP3alpha; |
Gene ID | 170685 |
mRNA Refseq | NM_153183 |
Protein Refseq | NP_694853 |
MIM | 300527 |
Uniprot ID | Q8NFP7 |
Chromosome Location | Xp11.22-p11.1 |
Function | diphosphoinositol-polyphosphate diphosphatase activity; hydrolase activity; metal ion binding; |
◆ Recombinant Proteins | ||
NUDT10-982H | Recombinant Human NUDT10, His-tagged | +Inquiry |
NUDT10-6709H | Recombinant Human NUDT10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NUDT10-1399H | Recombinant Human NUDT10, GST-tagged | +Inquiry |
NUDT10-28046TH | Recombinant Human NUDT10, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT10-3654HCL | Recombinant Human NUDT10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUDT10 Products
Required fields are marked with *
My Review for All NUDT10 Products
Required fields are marked with *
0
Inquiry Basket