Recombinant Human NUDT1 protein, His-tagged

• Cat.No.: NUDT1-6444H
• Product Overview: Recombinant Human NUDT1 protein(1-179 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-179 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: NUDT1
• Synonyms: NUDT1; nudix (nucleoside diphosphate linked moiety X)-type motif 1; MTH1; 7,8-dihydro-8-oxoguanine triphosphatase; 7; 8 dihydro 8 oxoguanine triphosphatase; 8 oxo 7; 8 dihydrodeoxyguanosine triphosphatase; 8 dihydroguanosine triphosphatase; 8 oxo dGTPase; mutT human homolog 1; nucleoside diphosphate linked moiety X type motif 1; nudix motif 1; 8-oxo-dGTPase; 2-hydroxy-dATP diphosphatase; 8-oxo-7,8-dihydroguanosine triphosphatase; 8-oxo-7,8-dihydrodeoxyguanosine triphosphatase; nucleoside diphosphate-linked moiety X motif 1; nucleoside diphosphate-linked moiety X-type motif 1
• Gene ID: 4521
• mRNA Refseq: NM_002452
• Protein Refseq: NP_002443
• MIM: 600312
• UniProt ID: P36639