Recombinant Human NUDT1 Protein (19-197 aa), His-tagged

Cat.No. : NUDT1-2411H
Product Overview : Recombinant Human NUDT1 Protein (19-197 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 19-197 aa
Description : Antimutagenic. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.3 kDa
AA Sequence : MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name NUDT1 nudix (nucleoside diphosphate linked moiety X)-type motif 1 [ Homo sapiens ]
Official Symbol NUDT1
Synonyms NUDT1; MTH1; 8 oxo 7; 8 oxo dGTPase; mutT human homolog 1; nudix motif 1; 8-oxo-dGTPase;
Gene ID 4521
mRNA Refseq NM_002452
Protein Refseq NP_002443
MIM 600312
UniProt ID P36639

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NUDT1 Products

Required fields are marked with *

My Review for All NUDT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon