Recombinant Human NUDT1 Protein (19-197 aa), His-tagged

• Cat.No.: NUDT1-2809H
• Product Overview: Recombinant Human NUDT1 Protein (19-197 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 19-197 aa
• Description: Antimutagenic. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.8 kDa
• AA Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: NUDT1 nudix (nucleoside diphosphate linked moiety X)-type motif 1 [ Homo sapiens ]
• Official Symbol: NUDT1
• Synonyms: NUDT1; MTH1; 8 oxo 7; 8 oxo dGTPase; mutT human homolog 1
• Gene ID: 4521
• mRNA Refseq: NM_002452
• Protein Refseq: NP_002443
• MIM: 600312
• UniProt ID: P36639