Recombinant Human NTF4 Protein
Cat.No. : | NTF4-219H |
Product Overview : | Recombinant Human NTF4 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Neurotrophin-4 (NT-4) is an important member of the nerve growth factor (NGF) family of proteins. Neurotrophins undergo paracrine and autocrine signaling to control neuronal survival, neuronal differentiation, and dendrite outgrowth. NT-4 is expressed ubiquitously and signals through the TrkB receptor tryrosine kinase. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | noncovalent homodimer, 14.1/28.1 kDa (131/262 aa) |
AA Sequence : | MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | NTF4 neurotrophin 4 [ Homo sapiens (human) ] |
Official Symbol | NTF4 |
Synonyms | NTF4; neurotrophin 4; neurotrophin 5 (neurotrophin 4/5) , NTF5; neurotrophin-4; GLC1O; neurotrophic factor 4; NT 4/5; neurotrophin-5; neutrophic factor 4; neurotrophic factor 5; neurotrophin 5 (neurotrophin 4/5); NT4; NT5; NT-4; NT-5; NTF5; GLC10; NT-4/5; |
Gene ID | 4909 |
mRNA Refseq | NM_006179 |
Protein Refseq | NP_006170 |
MIM | 162662 |
UniProt ID | P34130 |
◆ Recombinant Proteins | ||
NTF4-4099R | Recombinant Rat NTF4 Protein | +Inquiry |
NTF4-1385H | Recombinant Human NTF4, GST-tagged | +Inquiry |
NTF4-067N | Active Recombinant Human NTF4 Protein (260 aa) | +Inquiry |
NTF4-3114R | Recombinant Rhesus monkey NTF4 Protein, His-tagged | +Inquiry |
NTF4-2933R | Recombinant Rhesus Macaque NTF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTF4-3669HCL | Recombinant Human NTF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NTF4 Products
Required fields are marked with *
My Review for All NTF4 Products
Required fields are marked with *
0
Inquiry Basket