Recombinant Human NT5M Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NT5M-4489H
• Product Overview: NT5M MS Standard C13 and N15-labeled recombinant protein (NP_064586) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
• Molecular Mass: 25.9 kDa
• AA Sequence: MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NT5M 5',3'-nucleotidase, mitochondrial [ Homo sapiens (human) ]
• Official Symbol: NT5M
• Synonyms: NT5M; 5,3-nucleotidase, mitochondrial; 5 nucleotidase, mitochondrial; 5(3)-deoxyribonucleotidase, mitochondrial; dNT 2; dNT2; mdN; deoxy-5-nucleotidase 2; 5(3)-deoxyribonucleotidase; mitochondrial 5 nucleotidase; dNT-2
• Gene ID: 56953
• mRNA Refseq: NM_020201
• Protein Refseq: NP_064586
• MIM: 605292
• UniProt ID: Q9NPB1