Recombinant Human NRG4 protein, SUMO&His-tagged
| Cat.No. : | NRG4-4042H |
| Product Overview : | Recombinant Human NRG4 protein(Q8WWG1)(Pro11-Asn60), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | Pro11-Asn60 |
| Form : | Phosphate buffered saline |
| Storage : | Store at -20°C/-80°C. |
| AA Sequence : | PSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN |
| Official Symbol | NRG4 |
| Synonyms | NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; HRG4; pro-NRG4; heregulin 4; DKFZp779N0541; DKFZp779N1944; |
| Gene ID | 145957 |
| mRNA Refseq | NM_138573 |
| Protein Refseq | NP_612640 |
| MIM | 610894 |
| UniProt ID | Q8WWG1 |
| ◆ Recombinant Proteins | ||
| NRG4-333H | Recombinant Human NRG4 protein, His-tagged | +Inquiry |
| NRG4-452H | Recombinant Human NRG4 protein(Pro2-Phe62) | +Inquiry |
| NRG4-525H | Active Recombinant Human NRG4 | +Inquiry |
| Nrg4-12M | Recombinant Mouse neuregulin 4 Protein, His tagged | +Inquiry |
| Nrg4-1861R | Recombinant Rat Nrg4 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRG4 Products
Required fields are marked with *
My Review for All NRG4 Products
Required fields are marked with *
0
Inquiry Basket
