Recombinant Human NRG1 Protein, GMP Grade, Animal-Free
Cat.No. : | NRG1-31HG |
Product Overview : | GMP Recombinant Human NRG1 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Neuregulin/Heregulin is a family of structurally-related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms releases soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain; the latter is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity that leads to tyrosine phosphorylation. Although HRG1-β1's biological effects are still unclear, it has been found to promote motility and invasiveness of breast cancer cells, which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). |
AA Sequence : | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Gene Name | NRG1 neuregulin 1 [ Homo sapiens (human) ] |
Official Symbol | NRG1 |
Synonyms | NRG1; neuregulin 1; HGL; pro-neuregulin-1, membrane-bound isoform; GGF; HRG; NDF; MSTP131; pro-NRG1; glial growth factor; neu differentiation factor; neuregulin 1 type IV beta 3; neuregulin 1 type IV beta 1a; sensory and motor neuron derived factor; heregulin, alpha (45kD, ERBB2 p185-activator); ARIA; GGF2; HRG1; HRGA; SMDF; MST131; |
Gene ID | 3084 |
mRNA Refseq | NM_001159995 |
Protein Refseq | NP_001153467 |
MIM | 142445 |
UniProt ID | Q02297 |
◆ Cell & Tissue Lysates | ||
NRG1-836CCL | Recombinant Canine NRG1 cell lysate | +Inquiry |
NRG1-1675HCL | Recombinant Human NRG1 cell lysate | +Inquiry |
NRG1-001CCL | Recombinant Canine NRG1 cell lysate | +Inquiry |
NRG1-1591HCL | Recombinant Human NRG1 cell lysate | +Inquiry |
NRG1-1599HCL | Recombinant Human NRG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRG1 Products
Required fields are marked with *
My Review for All NRG1 Products
Required fields are marked with *
0
Inquiry Basket