Recombinant Human NRG1 protein

• Cat.No.: NRG1-678H
• Product Overview: Recombinant Human NRG1 protein (177-241 a.a.) was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 65
• Description: Neuregulin 1 belongs to a family of structurally related polypeptide growth factors and is produced in numerous isoforms by alternative splicing, which allows it to perform a wide variety of functions. These isoforms include heregulins (HRGs), glial growth factors (GGFs) and sensory and motor neuron-derived factor (SMDF). They all have the Ig and EGF-like domain, and can bind to ErbB3 and ErbB4 receptor tyrosin kinases. This binding induces ErbB3 and ErbB4 heterodimerization with ErbB2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. NRG1 isoforms have functions of inducing the growth and differentiation of epithelial, neuronal, glial, and other types of cells.
• Form: Lyophilized from a 0.2μm filtered solution in 1 × PBS, pH 7.4, with 5 % trehalose.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 0.5 ng/ml, corresponding to a specific activity of ＞ 2.0 × 106IU/mg.
• Molecular Mass: Approximately 7.5 kDa, a single non-glycosylated polypeptide chain containing 65 amino acids.
• AA Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
• Endotoxin: Less than 0.1 EU/μg of rHuNRG1-β1, 177-241a.a. as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: NRG1
• Official Symbol: NRG1
• Synonyms: NRG1; neuregulin 1; HGL; pro-neuregulin-1, membrane-bound isoform; GGF; HRG; NDF; MSTP131; pro-NRG1; glial growth factor; neu differentiation factor; neuregulin 1 type IV beta 3; neuregulin 1 type IV beta 1a; sensory and motor neuron derived factor; heregulin, alpha (45kD, ERBB2 p185-activator); ARIA; GGF2; HRG1; HRGA; SMDF; MST131
• Gene ID: 3084
• mRNA Refseq: NM_001159995
• Protein Refseq: NP_001153467
• MIM: 142445
• UniProt ID: Q02297