Recombinant Human NRBF2 Protein, GST-tagged

• Cat.No.: NRBF2-6108H
• Product Overview: Human NRBF2 full-length ORF ( AAH11707, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NRBF2 (Nuclear Receptor Binding Factor 2) is a Protein Coding gene. Among its related pathways are Gene Expression and Nuclear Receptor transcription pathway.
• Molecular Mass: 57.31 kDa
• AA Sequence: MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIAKEPDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NRBF2 nuclear receptor binding factor 2 [ Homo sapiens ]
• Official Symbol: NRBF2
• Synonyms: NRBF2; nuclear receptor binding factor 2; nuclear receptor-binding factor 2; COPR1; COPR2; DKFZp564C1664; FLJ30395; comodulator of PPAR and RXR; nuclear receptor binding factor-2; NRBF-2
• Gene ID: 29982
• mRNA Refseq: NM_030759
• Protein Refseq: NP_110386
• UniProt ID: Q96F24