Recombinant Full Length Human NRBF2 Protein, GST-tagged
Cat.No. : | NRBF2-6751HF |
Product Overview : | Human NRBF2 full-length ORF ( AAH11707, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 287 amino acids |
Description : | NRBF2 (Nuclear Receptor Binding Factor 2) is a Protein Coding gene. Among its related pathways are Gene Expression and Nuclear Receptor transcription pathway. |
Molecular Mass : | 57.31 kDa |
AA Sequence : | MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIAKEPDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NRBF2 nuclear receptor binding factor 2 [ Homo sapiens ] |
Official Symbol | NRBF2 |
Synonyms | NRBF2; nuclear receptor binding factor 2; nuclear receptor-binding factor 2; COPR1; COPR2; DKFZp564C1664; FLJ30395; comodulator of PPAR and RXR; nuclear receptor binding factor-2; NRBF-2; |
Gene ID | 29982 |
mRNA Refseq | NM_030759 |
Protein Refseq | NP_110386 |
MIM | 616477 |
UniProt ID | Q96F24 |
◆ Recombinant Proteins | ||
NRBF2-2917R | Recombinant Rhesus Macaque NRBF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NRBF2-4077R | Recombinant Rat NRBF2 Protein | +Inquiry |
NRBF2-353H | Recombinant Human NRBF2, His & GST-tagged | +Inquiry |
NRBF2-10881M | Recombinant Mouse NRBF2 Protein | +Inquiry |
NRBF2-6196M | Recombinant Mouse NRBF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRBF2-001HCL | Recombinant Human NRBF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRBF2 Products
Required fields are marked with *
My Review for All NRBF2 Products
Required fields are marked with *
0
Inquiry Basket