Recombinant Human NRARP Protein, GST-tagged

• Cat.No.: NRARP-6105H
• Product Overview: Human NRARP full-length ORF ( NP_001004354.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NRARP (NOTCH Regulated Ankyrin Repeat Protein) is a Protein Coding gene. Among its related pathways are Notch signaling pathway (KEGG).
• Molecular Mass: 38.9 kDa
• AA Sequence: MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NRARP NOTCH-regulated ankyrin repeat protein [ Homo sapiens ]
• Official Symbol: NRARP
• Synonyms: NRARP; NOTCH-regulated ankyrin repeat protein; notch-regulated ankyrin repeat-containing protein; MGC61598
• Gene ID: 441478
• mRNA Refseq: NM_001004354
• Protein Refseq: NP_001004354
• UniProt ID: Q7Z6K4