Recombinant Human NRARP Protein, GST-tagged
Cat.No. : | NRARP-6105H |
Product Overview : | Human NRARP full-length ORF ( NP_001004354.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NRARP (NOTCH Regulated Ankyrin Repeat Protein) is a Protein Coding gene. Among its related pathways are Notch signaling pathway (KEGG). |
Molecular Mass : | 38.9 kDa |
AA Sequence : | MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NRARP NOTCH-regulated ankyrin repeat protein [ Homo sapiens ] |
Official Symbol | NRARP |
Synonyms | NRARP; NOTCH-regulated ankyrin repeat protein; notch-regulated ankyrin repeat-containing protein; MGC61598; |
Gene ID | 441478 |
mRNA Refseq | NM_001004354 |
Protein Refseq | NP_001004354 |
UniProt ID | Q7Z6K4 |
◆ Recombinant Proteins | ||
NRARP-6105H | Recombinant Human NRARP Protein, GST-tagged | +Inquiry |
Nrarp-1606M | Recombinant Mouse Nrarp protein, His & T7-tagged | +Inquiry |
NRARP-6337H | Recombinant Human NRARP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Nrarp-4493M | Recombinant Mouse Nrarp Protein, Myc/DDK-tagged | +Inquiry |
NRARP-10879M | Recombinant Mouse NRARP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRARP-3703HCL | Recombinant Human NRARP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRARP Products
Required fields are marked with *
My Review for All NRARP Products
Required fields are marked with *
0
Inquiry Basket