Recombinant Human NRARP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NRARP-6337H
• Product Overview: NRARP MS Standard C13 and N15-labeled recombinant protein (NP_001004354) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: NRARP (NOTCH Regulated Ankyrin Repeat Protein) is a Protein Coding gene. Diseases associated with NRARP include Exudative Vitreoretinopathy 1. Among its related pathways are Notch Signaling Pathway (WikiPathways). An important paralog of this gene is ANKRD6.
• Molecular Mass: 12.5 kDa
• AA Sequence: MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NRARP NOTCH-regulated ankyrin repeat protein [ Homo sapiens (human) ]
• Official Symbol: NRARP
• Synonyms: NRARP; NOTCH-regulated ankyrin repeat protein; notch-regulated ankyrin repeat-containing protein; MGC61598
• Gene ID: 441478
• mRNA Refseq: NM_001004354
• Protein Refseq: NP_001004354
• UniProt ID: Q7Z6K4