Recombinant Human NR2F1 Protein, GST-tagged

Cat.No. : NR2F1-6084H
Product Overview : Human NR2F1 full-length ORF ( NP_005645.1, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a nuclear hormone receptor and transcriptional regulator. The encoded protein acts as a homodimer and binds to 5'-AGGTCA-3' repeats. Defects in this gene are a cause of Bosch-Boonstra optic atrophy syndrome (BBOAS). [provided by RefSeq, Apr 2014]
Molecular Mass : 72.60 kDa
AA Sequence : MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NR2F1 nuclear receptor subfamily 2, group F, member 1 [ Homo sapiens ]
Official Symbol NR2F1
Synonyms NR2F1; nuclear receptor subfamily 2, group F, member 1; ERBAL3, TFCOUP1; COUP transcription factor 1; COUP TFI; EAR 3; SVP44; TCFCOUP1; COUP-TF1; COUP-TF I; V-erbA-related protein 3; COUP transcription factor I; chicken ovalbumin upstream promoter-transcription factor I; transcription factor COUP 1 (chicken ovalbumin upstream promoter 1, v-erb-a homolog-like 3); EAR3; EAR-3; NR2F2; ERBAL3; TFCOUP1; COUP-TFI;
Gene ID 7025
mRNA Refseq NM_005654
Protein Refseq NP_005645
MIM 132890
UniProt ID P10589

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NR2F1 Products

Required fields are marked with *

My Review for All NR2F1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon