Recombinant Human NR2F1 Protein, GST-tagged

• Cat.No.: NR2F1-6084H
• Product Overview: Human NR2F1 full-length ORF ( NP_005645.1, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a nuclear hormone receptor and transcriptional regulator. The encoded protein acts as a homodimer and binds to 5'-AGGTCA-3' repeats. Defects in this gene are a cause of Bosch-Boonstra optic atrophy syndrome (BBOAS). [provided by RefSeq, Apr 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 72.60 kDa
• AA Sequence: MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NR2F1 nuclear receptor subfamily 2, group F, member 1 [ Homo sapiens ]
• Official Symbol: NR2F1
• Synonyms: NR2F1; nuclear receptor subfamily 2, group F, member 1; ERBAL3, TFCOUP1; COUP transcription factor 1; COUP TFI; EAR 3; SVP44; TCFCOUP1; COUP-TF1; COUP-TF I; V-erbA-related protein 3; COUP transcription factor I; chicken ovalbumin upstream promoter-transcription factor I; transcription factor COUP 1 (chicken ovalbumin upstream promoter 1, v-erb-a homolog-like 3); EAR3; EAR-3; NR2F2; ERBAL3; TFCOUP1; COUP-TFI
• Gene ID: 7025
• mRNA Refseq: NM_005654
• Protein Refseq: NP_005645
• MIM: 132890
• UniProt ID: P10589