Recombinant Human NR2F1 protein(1-423aa), His-tagged
Cat.No. : | NR2F1-3928H |
Product Overview : | Recombinant Human NR2F1 protein(P10589)(1-423aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-423aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS |
Gene Name | NR2F1 nuclear receptor subfamily 2, group F, member 1 [ Homo sapiens ] |
Official Symbol | NR2F1 |
Synonyms | NR2F1; nuclear receptor subfamily 2, group F, member 1; ERBAL3, TFCOUP1; COUP transcription factor 1; COUP TFI; EAR 3; SVP44; TCFCOUP1; COUP-TF1; COUP-TF I; V-erbA-related protein 3; COUP transcription factor I; chicken ovalbumin upstream promoter-transcription factor I; transcription factor COUP 1 (chicken ovalbumin upstream promoter 1, v-erb-a homolog-like 3); EAR3; EAR-3; NR2F2; ERBAL3; TFCOUP1; COUP-TFI; |
Gene ID | 7025 |
mRNA Refseq | NM_005654 |
Protein Refseq | NP_005645 |
MIM | 132890 |
UniProt ID | P10589 |
◆ Recombinant Proteins | ||
NR2F1-3928H | Recombinant Human NR2F1 protein(1-423aa), His-tagged | +Inquiry |
NR2F1-27964TH | Recombinant Human NR2F1 | +Inquiry |
NR2F1-6740HF | Recombinant Full Length Human NR2F1 Protein, GST-tagged | +Inquiry |
NR2F1-1413HFL | Recombinant Full Length Human NR2F1 Protein, C-Flag-tagged | +Inquiry |
NR2F1-01H | Recombinant Human NR2F1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR2F1-3710HCL | Recombinant Human NR2F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR2F1 Products
Required fields are marked with *
My Review for All NR2F1 Products
Required fields are marked with *
0
Inquiry Basket