Recombinant Human NPSR1 Protein, GST-tagged
Cat.No. : | NPSR1-5196H |
Product Overview : | Human GPR154 partial ORF ( NP_997056, 2 a.a. - 53 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq |
Molecular Mass : | 31.46 kDa |
AA Sequence : | PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPSR1 neuropeptide S receptor 1 [ Homo sapiens ] |
Official Symbol | NPSR1 |
Synonyms | NPSR1; neuropeptide S receptor 1; G protein coupled receptor 154, GPR154; neuropeptide S receptor; GPRA; PGR14; G protein-coupled receptor 154; G-protein coupled receptor 154; G-protein coupled receptor PGR14; vasopressin receptor-related receptor 1; G protein-coupled receptor for asthma susceptibility; G-protein coupled receptor for asthma susceptibility; NPSR; VRR1; ASRT2; GPR154; |
Gene ID | 387129 |
mRNA Refseq | NM_207172 |
Protein Refseq | NP_997055 |
MIM | 608595 |
UniProt ID | Q6W5P4 |
◆ Recombinant Proteins | ||
NPSR1-5196H | Recombinant Human NPSR1 Protein, GST-tagged | +Inquiry |
NPSR1-3082R | Recombinant Rhesus monkey NPSR1 Protein, His-tagged | +Inquiry |
NPSR1-6648HF | Recombinant Full Length Human NPSR1 Protein | +Inquiry |
RFL36747MF | Recombinant Full Length Mouse Neuropeptide S Receptor(Npsr1) Protein, His-Tagged | +Inquiry |
RFL14224RF | Recombinant Full Length Rat Neuropeptide S Receptor(Npsr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPSR1-3728HCL | Recombinant Human NPSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPSR1 Products
Required fields are marked with *
My Review for All NPSR1 Products
Required fields are marked with *
0
Inquiry Basket