Recombinant Human NPSR1 Protein, GST-tagged

• Cat.No.: NPSR1-5196H
• Product Overview: Human GPR154 partial ORF ( NP_997056, 2 a.a. - 53 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 31.46 kDa
• AA Sequence: PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPSR1 neuropeptide S receptor 1 [ Homo sapiens ]
• Official Symbol: NPSR1
• Synonyms: NPSR1; neuropeptide S receptor 1; G protein coupled receptor 154, GPR154; neuropeptide S receptor; GPRA; PGR14; G protein-coupled receptor 154; G-protein coupled receptor 154; G-protein coupled receptor PGR14; vasopressin receptor-related receptor 1; G protein-coupled receptor for asthma susceptibility; G-protein coupled receptor for asthma susceptibility; NPSR; VRR1; ASRT2; GPR154
• Gene ID: 387129
• mRNA Refseq: NM_207172
• Protein Refseq: NP_997055
• MIM: 608595
• UniProt ID: Q6W5P4