Recombinant Human NOXO1 Protein, GST-tagged

• Cat.No.: NOXO1-6011H
• Product Overview: Human NOXO1 partial ORF ( AAH15917, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NADPH oxidases (NOXs) catalyze the transfer of electrons from NADPH to molecular oxygen to generate reactive oxygen species (ROS). NOX organizers, such as NOXO1, target NOX activators (see NOXA1; MIM 611255) to NOX and also target NOX to different subcellular compartments (Opitz et al., 2007 [PubMed 17189823]).[supplied by OMIM
• Molecular Mass: 36.74 kDa
• AA Sequence: MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOXO1 NADPH oxidase organizer 1 [ Homo sapiens ]
• Official Symbol: NOXO1
• Synonyms: NOXO1; NADPH oxidase organizer 1; P41NOXA; P41NOXB; P41NOXC; SH3PXD5; SNX28; Nox organizer 1; nox-organizing protein 1; regulatory protein P41NOX; NADPH oxidase regulatory protein; SH3 and PX domain-containing protein 5; P41NOX; MGC20258
• Gene ID: 124056
• mRNA Refseq: NM_144603
• Protein Refseq: NP_653204
• MIM: 611256
• UniProt ID: Q8NFA2