Recombinant Human NOTUM Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NOTUM-1624H
• Product Overview: NOTUM MS Standard C13 and N15-labeled recombinant protein (NP_848588) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: NOTUM (Notum, Palmitoleoyl-Protein Carboxylesterase) is a Protein Coding gene. Diseases associated with NOTUM include Scalp-Ear-Nipple Syndrome and Suppurative Periapical Periodontitis. Among its related pathways are Signaling by GPCR and Regulation of activated PAK-2p34 by proteasome mediated degradation. Gene Ontology (GO) annotations related to this gene include hydrolase activity and palmitoleyl hydrolase activity.
• Molecular Mass: 48.6 kDa
• AA Sequence: MAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NOTUM notum, palmitoleoyl-protein carboxylesterase [ Homo sapiens (human) ]
• Official Symbol: NOTUM
• Synonyms: NOTUM; notum pectinacetylesterase homolog (Drosophila); protein notum homolog
• Gene ID: 147111
• mRNA Refseq: NM_178493
• Protein Refseq: NP_848588
• MIM: 609847
• UniProt ID: Q6P988