Recombinant Human NOTUM Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NOTUM-1624H
Product Overview : NOTUM MS Standard C13 and N15-labeled recombinant protein (NP_848588) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : NOTUM (Notum, Palmitoleoyl-Protein Carboxylesterase) is a Protein Coding gene. Diseases associated with NOTUM include Scalp-Ear-Nipple Syndrome and Suppurative Periapical Periodontitis. Among its related pathways are Signaling by GPCR and Regulation of activated PAK-2p34 by proteasome mediated degradation. Gene Ontology (GO) annotations related to this gene include hydrolase activity and palmitoleyl hydrolase activity.
Molecular Mass : 48.6 kDa
AA Sequence : MAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NOTUM notum, palmitoleoyl-protein carboxylesterase [ Homo sapiens (human) ]
Official Symbol NOTUM
Synonyms NOTUM; notum pectinacetylesterase homolog (Drosophila); protein notum homolog;
Gene ID 147111
mRNA Refseq NM_178493
Protein Refseq NP_848588
MIM 609847
UniProt ID Q6P988

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NOTUM Products

Required fields are marked with *

My Review for All NOTUM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon