Recombinant Human NOTCH2
Cat.No. : | NOTCH2-29660TH |
Product Overview : | Recombinant fragment of Human Notch 2 with N-terminal proprietary tag.Mol Wt 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Expressed in the brain, heart, kidney, lung, skeletal muscle and liver. Ubiquitously expressed in the embryo. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRD PCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTS HPCFVSRPCLNGGTCHMLSRDTYECTCQVG |
Sequence Similarities : | Belongs to the NOTCH family.Contains 6 ANK repeats.Contains 35 EGF-like domains.Contains 3 LNR (Lin/Notch) repeats. |
Gene Name | NOTCH2 notch 2 [ Homo sapiens ] |
Official Symbol | NOTCH2 |
Synonyms | NOTCH2; notch 2; Notch (Drosophila) homolog 2 , Notch homolog 2 (Drosophila); neurogenic locus notch homolog protein 2; |
Gene ID | 4853 |
mRNA Refseq | NM_001200001 |
Protein Refseq | NP_001186930 |
MIM | 600275 |
Uniprot ID | Q04721 |
Chromosome Location | 1p13-p11 |
Pathway | A third proteolytic cleavage releases NICD, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Dorso-ventral axis formation, organism-specific biosystem; Dorso-ventral axis formation, conserved biosystem; Gene Expression, organism-specific biosystem; |
Function | calcium ion binding; ligand-regulated transcription factor activity; protein binding; receptor activity; |
◆ Recombinant Proteins | ||
Notch2-1838M | Recombinant Mouse Notch2 Protein, His-tagged | +Inquiry |
Notch2-650M | Active Recombinant Mouse Notch2 Protein, Fc Chimera | +Inquiry |
Notch2-14R | Recombinant Rat Notch2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOTCH2-3072R | Recombinant Rhesus monkey NOTCH2 Protein, His-tagged | +Inquiry |
Notch2-436M | Recombinant Mouse Notch2, Fc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOTCH2 Products
Required fields are marked with *
My Review for All NOTCH2 Products
Required fields are marked with *
0
Inquiry Basket