Recombinant Human NOTCH1 Protein, GST-tagged

Cat.No. : NOTCH1-5996H
Product Overview : Human NOTCH1 partial ORF ( NP_060087, 23 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOTCH1 notch 1 [ Homo sapiens ]
Official Symbol NOTCH1
Synonyms NOTCH1; notch 1; Notch (Drosophila) homolog 1 (translocation associated) , Notch homolog 1, translocation associated (Drosophila) , TAN1; neurogenic locus notch homolog protein 1; Notch homolog 1, translocation-associated; translocation-associated notch protein TAN-1; hN1; TAN1;
Gene ID 4851
mRNA Refseq NM_017617
Protein Refseq NP_060087
MIM 190198
UniProt ID P46531

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NOTCH1 Products

Required fields are marked with *

My Review for All NOTCH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon