Recombinant Human NOTCH1 protein(2428-2555aa), His-GST&Myc-tagged

Cat.No. : NOTCH1-9118H
Product Overview : Recombinant Human NOTCH1 protein(P46531)(2428-2555aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : N-His-GST&C-Myc
Protein length : 2428-2555aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 48.7 kDa
AASequence : HLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name NOTCH1 notch 1 [ Homo sapiens ]
Official Symbol NOTCH1
Synonyms NOTCH1; notch 1; Notch (Drosophila) homolog 1 (translocation associated) , Notch homolog 1, translocation associated (Drosophila) , TAN1; neurogenic locus notch homolog protein 1; Notch homolog 1, translocation-associated; translocation-associated notch protein TAN-1; hN1; TAN1;
Gene ID 4851
mRNA Refseq NM_017617
Protein Refseq NP_060087
MIM 190198
UniProt ID P46531

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NOTCH1 Products

Required fields are marked with *

My Review for All NOTCH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon