Recombinant Human NOTCH1 protein(2428-2555aa), His-GST&Myc-tagged
Cat.No. : | NOTCH1-9118H |
Product Overview : | Recombinant Human NOTCH1 protein(P46531)(2428-2555aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 2428-2555aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK |
Gene Name | NOTCH1 notch 1 [ Homo sapiens ] |
Official Symbol | NOTCH1 |
Synonyms | NOTCH1; notch 1; Notch (Drosophila) homolog 1 (translocation associated) , Notch homolog 1, translocation associated (Drosophila) , TAN1; neurogenic locus notch homolog protein 1; Notch homolog 1, translocation-associated; translocation-associated notch protein TAN-1; hN1; TAN1; |
Gene ID | 4851 |
mRNA Refseq | NM_017617 |
Protein Refseq | NP_060087 |
MIM | 190198 |
UniProt ID | P46531 |
◆ Recombinant Proteins | ||
Notch1-2540R | Recombinant Rat Notch1, Fc Chimera | +Inquiry |
Notch1-1837M | Recombinant Mouse Notch1 Protein, His-tagged | +Inquiry |
NOTCH1-0570M | Active Recombinant Mouse NOTCH1 protein, His-tagged | +Inquiry |
NOTCH1-531H | Recombinant Human NOTCH1 protein, His-Avi-tagged | +Inquiry |
NOTCH1-2220C | Recombinant Chicken NOTCH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOTCH1-469MCL | Recombinant Mouse NOTCH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOTCH1 Products
Required fields are marked with *
My Review for All NOTCH1 Products
Required fields are marked with *
0
Inquiry Basket