Recombinant Human NOSIP Protein, GST-tagged

Cat.No. : NOSIP-5994H
Product Overview : Human NOSIP full-length ORF ( NP_057037.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene may modulate the activity and localization of nitric oxide synthase (endothelial and neuronal) and thus nitric oxide production. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2012]
Molecular Mass : 59.6 kDa
AA Sequence : MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOSIP nitric oxide synthase interacting protein [ Homo sapiens ]
Official Symbol NOSIP
Synonyms NOSIP; nitric oxide synthase interacting protein; nitric oxide synthase-interacting protein; CGI 25; eNOS interacting protein; eNOS-interacting protein; CGI-25;
Gene ID 51070
mRNA Refseq NM_015953
Protein Refseq NP_057037
UniProt ID Q9Y314

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NOSIP Products

Required fields are marked with *

My Review for All NOSIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon