Recombinant Full Length Human NOSIP Protein, GST-tagged

• Cat.No.: NOSIP-6713HF
• Product Overview: Human NOSIP full-length ORF ( NP_057037.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene may modulate the activity and localization of nitric oxide synthase (endothelial and neuronal) and thus nitric oxide production. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2012]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 59.6 kDa
• Protein length: 301 amino acids
• AA Sequence: MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOSIP nitric oxide synthase interacting protein [ Homo sapiens ]
• Official Symbol: NOSIP
• Synonyms: NOSIP; nitric oxide synthase interacting protein; nitric oxide synthase-interacting protein; CGI 25; eNOS interacting protein; eNOS-interacting protein; CGI-25
• Gene ID: 51070
• mRNA Refseq: NM_015953
• Protein Refseq: NP_057037
• MIM: 616759
• UniProt ID: Q9Y314