Recombinant Human NOS3

• Cat.No.: NOS3-28567TH
• Product Overview: Recombinant fragment corresponding to amino acids 61-160 of Human eNOS with a proprietary tag; Predicted MWt 36.63 kDa including tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. Variations in this gene are associated with susceptibility to coronary spasm. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Platelets, placenta, liver and kidney.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAAT
• Sequence Similarities: Belongs to the NOS family.Contains 1 FAD-binding FR-type domain.Contains 1 flavodoxin-like domain.

Gene Information

• Gene Name: NOS3 nitric oxide synthase 3 (endothelial cell) [ Homo sapiens ]
• Official Symbol: NOS3
• Synonyms: NOS3; nitric oxide synthase 3 (endothelial cell); nitric oxide synthase, endothelial; ECNOS; endothelial nitric oxide synthase; eNOS
• Gene ID: 4846
• mRNA Refseq: NM_000603
• Protein Refseq: NP_000594
• Uniprot ID: P29474
• Chromosome Location: 7q36
• Pathway: ACE Inhibitor Pathway, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Calcium signaling pathway, organism-specific biosystem
• Function: FMN binding; NADP binding; actin monomer binding; arginine binding; cadmium ion binding