Recombinant Human NONO, His-tagged

• Cat.No.: NONO-28748TH
• Product Overview: Recombinant fragment, corresponding to amino acids 185-471 of Human nmt55 / p54nrb with N terminal His tag; MWt 36kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 185-471 a.a.
• Description: This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
• Conjugation: HIS
• Tissue specificity: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Also found in a number of breast tumor cell lines.
• Form: Lyophilised:Reconstitute with 113 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTV EPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGS FEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEM EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRK QLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGP ATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAF NRAAPGAEFAPNKRRRY
• Sequence Similarities: Contains 2 RRM (RNA recognition motif) domains.

Gene Information

• Gene Name: NONO non-POU domain containing, octamer-binding [ Homo sapiens ]
• Official Symbol: NONO
• Synonyms: NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD
• Gene ID: 4841
• mRNA Refseq: NM_001145408
• Protein Refseq: NP_001138880
• MIM: 300084
• Uniprot ID: Q15233
• Chromosome Location: Xq13.1
• Pathway: Circadian rhythm pathway, organism-specific biosystem; mRNA processing, organism-specific biosystem
• Function: DNA binding; RNA binding; identical protein binding; nucleotide binding; protein binding