Recombinant Human NONO protein, GST-tagged

• Cat.No.: NONO-854H
• Product Overview: Recombinant Human NONO(101 a.a. - 210 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 101-210 a.a.
• Description: This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: GEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVE RAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: NONO non-POU domain containing, octamer-binding [ Homo sapiens ]
• Official Symbol: NONO
• Synonyms: NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD; P54; P54NRB; p54(nrb); 55 kDa nuclear protein; 54 kDa nuclear RNA- and DNA-binding protein; DNA-binding p52/p100 complex, 52 kDa subunit; non-POU domain-containing octamer (ATGCAAAT) binding protein
• Gene ID: 4841
• mRNA Refseq: NM_007363
• Protein Refseq: NP_031389
• MIM: 300084
• UniProt ID: Q15233
• Chromosome Location: Xq13.1
• Pathway: Circadian rhythm pathway, organism-specific biosystem; mRNA processing, organism-specific biosystem
• Function: DNA binding; RNA binding; identical protein binding; nucleotide binding; protein binding