Recombinant Human NODAL

• Cat.No.: NODAL-30448TH
• Product Overview: Recombinant fragment, corresponding to amino acids 275-346 of Human Nodal, with an N-terminal proprietary tag, predicted MWt 33.55kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 72 amino acids
• Description: The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.
• Molecular Weight: 33.550kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
• Sequence Similarities: Belongs to the TGF-beta family.

Gene Information

• Gene Name: NODAL nodal homolog (mouse) [ Homo sapiens ]
• Official Symbol: NODAL
• Synonyms: NODAL; nodal homolog (mouse); nodal, mouse, homolog; nodal homolog
• Gene ID: 4838
• mRNA Refseq: NM_018055
• Protein Refseq: NP_060525
• MIM: 601265
• Uniprot ID: Q96S42
• Chromosome Location: 10q22.1
• Pathway: Developmental Biology, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: cytokine activity; growth factor activity