Recombinant Human NNMT Protein, GST-tagged
Cat.No. : | NNMT-5956H |
Product Overview : | Human NNMT full-length ORF ( AAH00234, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq |
Molecular Mass : | 54.78 kDa |
AA Sequence : | MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NNMT nicotinamide N-methyltransferase [ Homo sapiens ] |
Official Symbol | NNMT |
Synonyms | NNMT; nicotinamide N-methyltransferase; |
Gene ID | 4837 |
mRNA Refseq | NM_006169 |
Protein Refseq | NP_006160 |
MIM | 600008 |
UniProt ID | P40261 |
◆ Recombinant Proteins | ||
NNMT-218H | Recombinant Human NNMT protein, His-tagged | +Inquiry |
NNMT-5956H | Recombinant Human NNMT Protein, GST-tagged | +Inquiry |
NNMT-017H | Recombinant Human NNMT Protein, His/SUMO-tagged | +Inquiry |
NNMT-4714H | Recombinant Human NNMT Protein (Met1-Arg258), His tagged | +Inquiry |
NNMT-149H | Recombinant Human NNMT protein, His/SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NNMT-3779HCL | Recombinant Human NNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NNMT Products
Required fields are marked with *
My Review for All NNMT Products
Required fields are marked with *
0
Inquiry Basket