Recombinant Human NMNAT3 Protein, GST-tagged

• Cat.No.: NMNAT3-5942H
• Product Overview: Human NMNAT3 full-length ORF ( NP_835471.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD (Zhang et al., 2003 [PubMed 12574164]).[supplied by OMIM
• Molecular Mass: 50.5 kDa
• AA Sequence: MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NMNAT3 nicotinamide nucleotide adenylyltransferase 3 [ Homo sapiens ]
• Official Symbol: NMNAT3
• Synonyms: NMNAT3; nicotinamide nucleotide adenylyltransferase 3; nicotinamide mononucleotide adenylyltransferase 3; PNAT3; NMN adenylyltransferase 3; NaMN adenylyltransferase 3; pyridine nucleotide adenylyltransferase 3; nicotinate-nucleotide adenylyltransferase 3; FKSG76; PNAT-3
• Gene ID: 349565
• mRNA Refseq: NM_001200047
• Protein Refseq: NP_001186976
• MIM: 608702
• UniProt ID: Q96T66