Recombinant Human NME4, His-tagged

• Cat.No.: NME4-28746TH
• Product Overview: Recombinant full length Human mature NME4 with an N terminal His tag; 176 amino acids, predicted MWt 19.6kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 155 amino acids
• Description: The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al.
• Conjugation: HIS
• Molecular Weight: 19.600kDa inclusive of tags
• Tissue specificity: Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
• Sequence Similarities: Belongs to the NDK family.

Gene Information

• Gene Name: NME4 non-metastatic cells 4, protein expressed in [ Homo sapiens ]
• Official Symbol: NME4
• Synonyms: NME4; non-metastatic cells 4, protein expressed in; nucleoside diphosphate kinase, mitochondrial; nm23 H4; NM23H4
• Gene ID: 4833
• mRNA Refseq: NM_005009
• Protein Refseq: NP_005000
• MIM: 601818
• Uniprot ID: O00746
• Chromosome Location: 16p13.3
• Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem
• Function: ATP binding; kinase activity; metal ion binding; nucleoside diphosphate kinase activity; nucleoside diphosphate kinase activity