Recombinant Human NME3, His-tagged

• Cat.No.: NME3-28749TH
• Product Overview: Recombinant fragment corresponding to amino acids 22-169 of Human NME3 with an N terminal His tag; 169 amino acids with tag, MWt 19.1 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 148 amino acids
• Description: Nucleoside diphosphate kinase 3 is an enzyme that in humans is encoded by the NME3 gene.
• Conjugation: HIS
• Molecular Weight: 19.100kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 50% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE

Gene Information

• Gene Name: NME3 non-metastatic cells 3, protein expressed in [ Homo sapiens ]
• Official Symbol: NME3
• Synonyms: NME3; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase 3; DR nm23
• Gene ID: 4832
• mRNA Refseq: NM_002513
• Protein Refseq: NP_002504
• MIM: 601817
• Uniprot ID: Q13232
• Chromosome Location: 16q13.3
• Pathway: Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem
• Function: ATP binding; kinase activity; metal ion binding; nucleoside diphosphate kinase activity; nucleotide binding