Recombinant Human NME3 protein, GST-tagged

• Cat.No.: NME3-1312H
• Product Overview: Recombinant Human NME3 protein(22-169 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 22-169 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: NME3
• Synonyms: NME3; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase 3; DR nm23; NM23 H3; NDK 3; NDP kinase 3; NDP kinase C; nucleoside diphosphate kinase C; NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2; KIAA0516
• Gene ID: 4832
• mRNA Refseq: NM_002513
• Protein Refseq: NP_002504
• MIM: 601817
• UniProt ID: Q13232