Recombinant Human NME2 protein, His-tagged

• Cat.No.: NME2-1311H
• Product Overview: Recombinant Human NME2 protein(1-152 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 1-152 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: NME2 non-metastatic cells 2, protein (NM23B) expressed in [ Homo sapiens ]
• Official Symbol: NME2
• Synonyms: NME2; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase B; NM23 H2; NDP kinase B; c-myc transcription factor; histidine protein kinase NDKB; nucleotide diphosphate kinase B; c-myc purine-binding transcription factor PUF; non-metastatic cells 2, protein (NM23) expressed in; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2; MGC2212; MGC111212
• mRNA Refseq: NM_001018137
• Protein Refseq: NP_001018147
• MIM: 156491
• UniProt ID: P22392
• Gene ID: 4831