Recombinant Human NLRC4 Protein, GST-Tagged

• Cat.No.: NLRC4-1317H
• Product Overview: Human CARD12 partial ORF (AAH31555, 531 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the caspase recruitment domain-containing NLR family. Family members play essential roles in innate immune response to a wide range of pathogenic organisms, tissue damage and other cellular stresses. Mutations in this gene result in autoinflammation with infantile enterocolitis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
• Molecular Mass: 36.63 kDa
• AA Sequence: QESLQSVKNTTEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFEHLPNCASALDFIKLDFYGGAMASWEKAAED
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NLRC4 NLR family, CARD domain containing 4 [ Homo sapiens ]
• Official Symbol: NLRC4
• Synonyms: NLRC4; NLR family, CARD domain containing 4; CARD12, caspase recruitment domain family, member 12; NLR family CARD domain-containing protein 4; CLAN; CLAN1; CLANA; CLANB; CLANC; CLAND; CLR2.1; ipaf; NOD like receptor C4; nucleotide binding oligomerization domain; leucine rich repeat and CARD domain containing 4; NOD-like receptor C4; ICE-protease activating factor; ice protease-activating factor; CARD, LRR, and NACHT-containing protein; caspase recruitment domain family, member 12; caspase recruitment domain-containing protein 12; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 4; IPAF; CARD12
• Gene ID: 58484
• mRNA Refseq: NM_001199138
• Protein Refseq: NP_001186067
• MIM: 606831
• UniProt ID: Q9NPP4