Recombinant Human NLGN4Y Protein, GST-tagged

Cat.No. : NLGN4Y-5914H
Product Overview : Human NLGN4Y full-length ORF ( AAH32567, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Neuroligins, such as NLGN4Y, are cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses (Jamain et al., 2003 [PubMed 12669065]).[supplied by OMIM
Molecular Mass : 40.48 kDa
AA Sequence : MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NLGN4Y neuroligin 4, Y-linked [ Homo sapiens ]
Official Symbol NLGN4Y
Synonyms NLGN4Y; neuroligin 4, Y-linked; neuroligin 4, Y linked; neuroligin-4, Y-linked; KIAA0951;
Gene ID 22829
mRNA Refseq NM_001164238
Protein Refseq NP_001157710
MIM 400028
UniProt ID Q8NFZ3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NLGN4Y Products

Required fields are marked with *

My Review for All NLGN4Y Products

Required fields are marked with *

0

Inquiry Basket

cartIcon