Recombinant Human NLGN4Y Protein, His-tagged
Cat.No. : | NLGN4Y-24H |
Product Overview : | Recombinant human NLGN4Y protein with a His-tag was expressed in HEK293 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene encodes a type I membrane protein that belongs to the family of neuroligins, which are cell adhesion molecules present at the postsynaptic side of the synapse, and may be essential for the formation of functional synapses. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | The protein has a calculated MW of 22.8 kDa. |
AA Sequence : | NYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFAHHHHHHHHHH |
Endotoxin : | <1 EU/μg |
Purity : | >95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.23 mg/mL |
Storage Buffer : | PBS, pH7.4, 0.05% SKL |
Gene Name | NLGN4Y neuroligin 4, Y-linked [ Homo sapiens (human) ] |
Official Symbol | NLGN4Y |
Synonyms | NLGN4Y; neuroligin 4, Y-linked; neuroligin 4, Y linked; neuroligin-4, Y-linked; KIAA0951; |
Gene ID | 22829 |
mRNA Refseq | NM_001164238 |
Protein Refseq | NP_001157710 |
MIM | 400028 |
UniProt ID | Q8NFZ3 |
◆ Recombinant Proteins | ||
NLGN4Y-395H | Recombinant Human NLGN4Y Protein, His-tagged | +Inquiry |
NLGN4Y-6715HF | Recombinant Full Length Human NLGN4Y Protein, GST-tagged | +Inquiry |
NLGN4Y-3043R | Recombinant Rhesus monkey NLGN4Y Protein, His-tagged | +Inquiry |
NLGN4Y-01H | Recombinant Human NLGN4Y Protein(Q8NFZ3-1, Gln44-Leu675), His-tagged | +Inquiry |
NLGN4Y-2862R | Recombinant Rhesus Macaque NLGN4Y Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLGN4Y-3807HCL | Recombinant Human NLGN4Y 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NLGN4Y Products
Required fields are marked with *
My Review for All NLGN4Y Products
Required fields are marked with *
0
Inquiry Basket