Recombinant Human NLGN4Y Protein, His-tagged

• Cat.No.: NLGN4Y-24H
• Product Overview: Recombinant human NLGN4Y protein with a His-tag was expressed in HEK293

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: This gene encodes a type I membrane protein that belongs to the family of neuroligins, which are cell adhesion molecules present at the postsynaptic side of the synapse, and may be essential for the formation of functional synapses. Alternatively spliced transcript variants have been found for this gene.
• Molecular Mass: The protein has a calculated MW of 22.8 kDa.
• AA Sequence: NYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFAHHHHHHHHHH
• Endotoxin: <1 EU/μg
• Purity: >95% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.23 mg/mL
• Storage Buffer: PBS, pH7.4, 0.05% SKL

Gene Information

• Gene Name: NLGN4Y neuroligin 4, Y-linked [ Homo sapiens (human) ]
• Official Symbol: NLGN4Y
• Synonyms: NLGN4Y; neuroligin 4, Y-linked; neuroligin 4, Y linked; neuroligin-4, Y-linked; KIAA0951
• Gene ID: 22829
• mRNA Refseq: NM_001164238
• Protein Refseq: NP_001157710
• MIM: 400028
• UniProt ID: Q8NFZ3